EST translation and GO annotation for unigene RU24434


ESTScan predicted protein sequence

MEQLSPXVDSGKTALDMLKPPHNFDACFMDLQMPEMDGFEATRRIRCLESEVNEKIASGEAPIEMFGNVENWHTPX

ESTScan predicted coding region in original sequence      Start : 8 End : 233 Strand : plus

AAATAATATGGAGCAATTGTCACCTGXTGTTGATAGTGGGAAGACTGCTTTAGACATGCTTAAGCCACCACACAACTTTGACGCTTGCTT
TATGGACCTCCAAATGCCAGAAATGGACGGATTCGAAGCAACTCGTCGAATTCGCTGTCTGGAGAGTGAGGTTAATGAGAAAATTGCATC
TGGGGAAGCACCAATCGAGATGTTTGGCAATGTGGAGAATTGGCACACACCAATX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00072    Response regulator receiver domain

        GO:0000156     GO:0000156

        GO:0000160     GO:0000160

        GO:0006355     GO:0006355

GO terms for RU24434 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0000160-two-component signal transduction system (phosphorelay)
  GO:0006355-regulation of transcription, DNA-dependent
  GO:0007165-signal transduction
  GO:0016310-phosphorylation
  GO:0018106-peptidyl-histidine phosphorylation
GO Molecular Function
   GO:0000155-two-component sensor activity
  GO:0000156-two-component response regulator activity
  GO:0004673-protein histidine kinase activity
  GO:0004871-signal transducer activity
  GO:0004872-receptor activity
  GO:0005524-ATP binding
  GO:0016772-transferase activity, transferring phosphorus-containing groups
GO Cellular Component
   GO:0016020-membrane