EST translation and GO annotation for unigene RU25415


ESTScan predicted protein sequence

XYINNSGTETNVYKQYPPSNQVDEFPERPGQPLCSFFLRTGDCKFKSNCKYHH

ESTScan predicted coding region in original sequence      Start : 1 End : 158 Strand : plus


XATTATATCAACAACTCAGGGACCGAAACCAATGTTTATAAACAATATCCACCGTCAAATCAAGTTGATGAATTCCCAGAACGACCTGGA
CAACCTTTGTGCAGTTTCTTTTTAAGAACAGGGGACTGTAAGTTTAAATCTAACTGCAAATATCATCAT


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00642    Zinc finger C-x8-C-x5-C-x3-H type (and similar)

        GO:0003676     GO:0003676

        GO:0008270     GO:0008270

GO terms for RU25415 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
  GO:0003676-nucleic acid binding
  GO:0008270-zinc ion binding
  GO:0046872-metal ion binding
GO Cellular Component