EST translation and GO annotation for unigene RU28535


ESTScan predicted protein sequence

XNKPAQRSGSSRRTRAAEVHNLSERRRRDRINEKMKALQELIPHSNKTD

ESTScan predicted coding region in original sequence      Start : 1 End : 145 Strand : minus


XXAAACAAGCCAGCGCAACGATCAGGATCATCGAGGAGGACACGTGCTGCTGAAGTCCATAATCTCTCAGAAAGGAGACGAAGAGATCGG
ATCAATGAGAAAATGAAGGCACTGCAAGAGCTCATACCTCATTCTAACAAGACAGAC


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00010    Helix-loop-helix DNA-binding domain

        GO:0005634     GO:0005634

        GO:0030528     GO:0030528

        GO:0045449     GO:0045449

GO terms for RU28535 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0045449-regulation of transcription
GO Molecular Function
   GO:0030528-transcription regulator activity
GO Cellular Component
   GO:0005634-nucleus