EST translation and GO annotation for unigene RU28619


ESTScan predicted protein sequence

XMVYKFHEDEHGEVLAESKRPDLEPYLGLHYPATDIPQASRFLFKQNRVRMIVX

ESTScan predicted coding region in original sequence      Start : 1 End : 159 Strand : minus


XTTATGGTGTACAAGTTTCATGAGGATGAGCACGGGGAGGTTTTGGCGGAGAGTAAGAGGCCGGATTTGGAGCCTTATCTTGGCCTGCAT
TATCCGGCCACGGATATACCTCAGGCGTCGAGGTTTTTGTTCAAGCAGAATAGGGTGAGAATGATTGTGGXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU28619 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006355-regulation of transcription, DNA-dependent
  GO:0007600-sensory perception
  GO:0018298-protein-chromophore linkage
  GO:0045449-regulation of transcription
GO Molecular Function
   GO:0004872-receptor activity
  GO:0008020-G-protein coupled photoreceptor activity
  GO:0009881-photoreceptor activity
GO Cellular Component