EST translation and GO annotation for unigene RU28640


ESTScan predicted protein sequence

TIPSAPVYYPSEDEFRDPLEYICKIRAEAEPYGICRIVPPSSWR

ESTScan predicted coding region in original sequence      Start : 1 End : 132 Strand : plus


ACCATACCATCTGCACCTGTGTATTACCCTAGTGAGGATGAGTTTAGGGATCCTTTGGAGTATATATGTAAGATCAGGGCTGAGGCTGAG
CCCTACGGGATTTGTAGGATAGTTCCGCCGAGTAGCTGGAGG


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF02375    jmjN domain

GO terms for RU28640 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
   GO:0003677-DNA binding
  GO:0005515-protein binding
  GO:0008270-zinc ion binding
  GO:0046872-metal ion binding
GO Cellular Component
   GO:0005622-intracellular
  GO:0005634-nucleus