Rose Transcriptome Database

EST translation and GO annotation for unigene RU28836

ESTScan predicted protein sequence

XINSMSLKSAIQLGIPDLRDMEFMKLKMWFQMWA

ESTScan predicted coding region in original sequence Start : 1 End : 103 Strand : plus

XXCATAAACTCCATGTCCCTCAAATCTGCAATTCAACTAGGTATACCAGATTTGAGGGACATGGAGTTTATGAAGCTGAAGATGTGGTTC
CAGATGTGGGCTTGAGCATGAAGTAGCTCGTTGGAATGCTCTCCATTTGACCATTTTTGGTTAAGGTGTCTAAAGCTG

X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS

InterProtein domain annotations

Pfam domain annotations

GO terms for RU28836 (based on the top Swiss-Prot and TrEMBL hits)

GO Biological Process

GO Molecular Function

  GO:0008168-methyltransferase activity
  GO:0008171-O-methyltransferase activity
  GO:0016740-transferase activity
  GO:0046983-protein dimerization activity