EST translation and GO annotation for unigene RU30149


ESTScan predicted protein sequence

XGVRGGPVDPAKLVVELAPMEIRTFLIDLEQKFFHRRHHHHHDVSD

ESTScan predicted coding region in original sequence      Start : 1 End : 136 Strand : plus


XXGGGTGTGAGGGGTGGACCTGTTGATCCTGCAAAACTAGTTGTGGAACTTGCCCCAATGGAGATCCGCACCTTTCTCATAGACTTGGAG
CAGAAGTTCTTCCACCGCCGCCATCATCATCATCATGATGTATCTGAT


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU30149 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0005975-carbohydrate metabolic process
  GO:0006013-mannose metabolic process
GO Molecular Function
   GO:0003824-catalytic activity
  GO:0004553-hydrolase activity, hydrolyzing O-glycosyl compounds
  GO:0004559-alpha-mannosidase activity
  GO:0008270-zinc ion binding
  GO:0015923-mannosidase activity
  GO:0030246-carbohydrate binding
GO Cellular Component