EST translation and GO annotation for unigene RU30202


ESTScan predicted protein sequence

MENKVDEVVAVELPAPPAWKKKILPKKGVTPSSNR

ESTScan predicted coding region in original sequence      Start : 75 End : 179 Strand : minus

TGTTTAGAGCGAGAAGGAGAAGAAGAAGAAGAAGAGGGCTTTTCAAGTTTTGGGATTTGAATAATTCTGAAAAAATGGAGAACAAAGTGG
ATGAGGTTGTTGCTGTTGAGCTACCTGCTCCTCCTGCTTGGAAGAAGAAGATTTTACCCAAGAAGGGAGTTACACCAAGTTCCAACAGA


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU30202 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
GO Cellular Component