EST translation and GO annotation for unigene RU30785


ESTScan predicted protein sequence

XIILDDIWKGIDFSRIGIPSHNELQKCNSKVLLTTRRLKVCSIMGSHAKIPLKILSEADS

ESTScan predicted coding region in original sequence      Start : 1 End : 178 Strand : plus


XXCATAATCTTGGATGACATTTGGAAGGGAATAGACTTTTCAAGAATTGGAATTCCGAGCCACAACGAACTTCAAAAATGCAATTCCAAA
GTCTTATTGACCACCAGAAGATTGAAAGTTTGTAGTATCATGGGGAGCCATGCAAAAATTCCTCTCAAAATCTTATCAGAAGCAGATTCT



X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU30785 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
  GO:0006915-apoptosis
  GO:0006952-defense response
GO Molecular Function
  GO:0005524-ATP binding
GO Cellular Component