EST translation and GO annotation for unigene RU31063


ESTScan predicted protein sequence

XILKAYRTYITACPFKKMSNFYANQTIRKLAEEX

ESTScan predicted coding region in original sequence      Start : 1 End : 100 Strand : minus


XTTATCTTGAAAGCTTACCGGACTTACATCACAGCATGCCCCTTTAAGAAGATGTCCAATTTTTATGCTAACCAAACGATTCGCAAGCTG
GCAGAGGAGAAX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU31063 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
GO Cellular Component