EST translation and GO annotation for unigene RU33297


ESTScan predicted protein sequence

RHKKQLKEEFDVEPWTFEQHLGEAVFIPAGCPHQVQSLIMNRMN

ESTScan predicted coding region in original sequence      Start : 1 End : 132 Strand : minus


AGACATAAGAAACAACTAAAGGAGGAGTTCGATGTGGAGCCTTGGACATTTGAGCAACATCTTGGTGAGGCAGTTTTTATTCCAGCTGGA
TGTCCTCATCAAGTACAGAGTCTGATCATGAATAGGATGAAC


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF02373    JmjC domain

GO terms for RU33297 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
  GO:0005515-protein binding
  GO:0008270-zinc ion binding
GO Cellular Component