EST translation and GO annotation for unigene RU33428


ESTScan predicted protein sequence

KXSKLFNLSAFKGSICPDDFTELVTEVRHYAKGIPLVLEVLGSDLCGKDKDEQX

ESTScan predicted coding region in original sequence      Start : 1 End : 159 Strand : minus


AAGXCGTCAAAGCTCTTCAATTTAAGTGCTTTCAAAGGAAGTATATGTCCGGATGACTTCACTGAACTTGTAACTGAGGTAAGACATTAT
GCTAAAGGGATTCCGTTAGTTTTGGAAGTTTTGGGGTCAGATCTATGTGGTAAAGATAAGGATGAGCAGGXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU33428 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006915-apoptosis
  GO:0007165-signal transduction
  GO:0045087-innate immune response
GO Molecular Function
   GO:0004888-transmembrane receptor activity
  GO:0005524-ATP binding
GO Cellular Component
   GO:0031224-intrinsic to membrane