EST translation and GO annotation for unigene RU33904


ESTScan predicted protein sequence

SMHLGVLATASHAIATGTLFSVFYKPRTSRSEFLVSVNKYLEARSHKLSVGMRFKMRFEGEEVPX

ESTScan predicted coding region in original sequence      Start : 1 End : 194 Strand : plus


AGTATGCATCTTGGAGTCCTAGCTACTGCATCTCATGCCATTGCAACTGGGACACTATTTTCGGTCTTCTACAAGCCAAGAACAAGTCGA
TCTGAGTTCCTTGTTAGTGTCAACAAGTACCTTGAAGCTCGCAGTCACAAACTCTCTGTTGGGATGAGGTTTAAGATGAGATTTGAGGGT
GAGGAAGTTCCTGAX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF06507    Auxin response factor

        GO:0003677     GO:0003677

        GO:0005634     GO:0005634

        GO:0009725     GO:0009725

        GO:0045449     GO:0045449

GO terms for RU33904 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006350-transcription
  GO:0006355-regulation of transcription, DNA-dependent
  GO:0009725-response to hormone stimulus
  GO:0009734-auxin mediated signaling pathway
  GO:0045449-regulation of transcription
GO Molecular Function
   GO:0003677-DNA binding
GO Cellular Component
   GO:0005634-nucleus