EST translation and GO annotation for unigene RU34083


ESTScan predicted protein sequence

KVLESLGKDIVKRCKGLPLLAKVLGGLMRSKKTKKEWQDVLSSKIWGLDKVEQQVFRPLL

ESTScan predicted coding region in original sequence      Start : 1 End : 180 Strand : minus


AAAGTGTTAGAATCTTTGGGTAAAGACATTGTAAAACGGTGTAAAGGTTTGCCTCTTCTTGCAAAGGTTTTAGGCGGTCTAATGCGCTCT
AAGAAAACCAAGAAAGAATGGCAAGATGTTTTGAGTAGTAAGATATGGGGGTTAGACAAAGTGGAGCAACAAGTTTTCCGACCGCTATTA



X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00931    NB-ARC domain

        GO:0005524     GO:0005524

        GO:0006915     GO:0006915

GO terms for RU34083 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006915-apoptosis
GO Molecular Function
   GO:0000166-nucleotide binding
  GO:0005515-protein binding
  GO:0005524-ATP binding
GO Cellular Component