EST translation and GO annotation for unigene RU34301


ESTScan predicted protein sequence

DEKTPCIIGNTSNGDSSVISVPLPQVSENHASITYKDGGFYLSDLRSKYGTWLX

ESTScan predicted coding region in original sequence      Start : 1 End : 160 Strand : plus


GATGAGAAAACCCCCTGCATAATTGGGAACACCTCAAATGGGGATTCATCAGTAATATCAGTTCCATTACCCCAGGTTTCAGAAAATCAT
GCTTCTATCACCTACAAGGATGGTGGTTTTTACCTATCTGATTTGCGAAGCAAATATGGTACCTGGCTCGXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00498    FHA domain

GO terms for RU34301 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0008152-metabolic process
  GO:0009688-abscisic acid biosynthetic process
  GO:0055114-oxidation reduction
GO Molecular Function
   GO:0009055-electron carrier activity
  GO:0009540-zeaxanthin epoxidase activity
  GO:0016491-oxidoreductase activity
GO Cellular Component
   GO:0009507-chloroplast
  GO:0016020-membrane