EST translation and GO annotation for unigene RU34308


ESTScan predicted protein sequence

XLISDYHQAMNPQGQVKEAPLPVPLERLNDQGPPPFLNKTYEIVEDSTTNHIVSWSKANNX

ESTScan predicted coding region in original sequence      Start : 1 End : 180 Strand : minus


XXACTGATTAGTGATTACCATCAAGCAATGAACCCCCAAGGTCAAGTAAAGGAGGCACCTTTACCAGTGCCACTGGAGAGACTTAATGAC
CAAGGCCCTCCCCCATTTCTCAACAAAACCTATGAAATTGTGGAAGACTCAACAACCAACCACATAGTGTCTTGGAGCAAAGCAAACAAC
AGX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00447    HSF-type DNA-binding

        GO:0003700     GO:0003700

        GO:0005634     GO:0005634

        GO:0006355     GO:0006355

        GO:0043565     GO:0043565

GO terms for RU34308 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006355-regulation of transcription, DNA-dependent
  GO:0006950-response to stress
GO Molecular Function
   GO:0003677-DNA binding
  GO:0003700-transcription factor activity
  GO:0043565-sequence-specific DNA binding
GO Cellular Component
   GO:0005634-nucleus