EST translation and GO annotation for unigene RU34912


ESTScan predicted protein sequence

MPDESVSIQNPRDRLLRVVKSLSPKVVTLVEQESNTNX

ESTScan predicted coding region in original sequence      Start : 50 End : 161 Strand : plus

CTACTTTGTCTAGTTGTAATTTTTGTCCTTTCTATTGTCTTGTCACCACATGCCAGATGAGAGTGTGAGCATCCAAAATCCTAGGGACCG
GCTGTTGAGGGTGGTTAAGAGCTTGTCTCCCAAGGTTGTGACTCTTGTTGAGCAAGAATCAAACACCAACAXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF03514    GRAS family transcription factor

GO terms for RU34912 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
  GO:0006350-transcription
  GO:0006355-regulation of transcription, DNA-dependent
GO Molecular Function
GO Cellular Component