EST translation and GO annotation for unigene RU34969


ESTScan predicted protein sequence

ITVPPSDMGEGLKAFLDSGAGCDVVFQVGDEQFKAHKLILAARSPVFKAX

ESTScan predicted coding region in original sequence      Start : 1 End : 149 Strand : minus


ATTACTGTACCACCATCAGACATGGGTGAAGGTCTCAAGGCTTTTCTAGATTCTGGAGCTGGTTGCGACGTAGTTTTTCAGGTTGGTGAT
GAGCAATTTAAAGCTCACAAGTTGATACTTGCTGCTCGTTCTCCTGTATTCAAAGCACAX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00651    BTB/POZ domain

        GO:0005515     GO:0005515

GO terms for RU34969 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
   GO:0005515-protein binding
GO Cellular Component