EST translation and GO annotation for unigene RU35125


ESTScan predicted protein sequence

LWDIPESACVGGKEWYFYSQRDRKYATGLRTNRATATGYWKATG

ESTScan predicted coding region in original sequence      Start : 1 End : 131 Strand : plus


CTTTGGGACATTCCTGAAAGTGCATGTGTCGGAGGAAAGGAATGGTATTTCTACAGTCAGCGTGATCGGAAATATGCGACGGGGCTTCGA
ACAAACCGAGCAACTGCAACTGGGTATTGGAAGGCCACCGGX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF02365    No apical meristem (NAM) protein

        GO:0003677     GO:0003677

        GO:0045449     GO:0045449

GO terms for RU35125 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
  GO:0045449-regulation of transcription
GO Molecular Function
  GO:0003677-DNA binding
GO Cellular Component