EST translation and GO annotation for unigene RU35209


ESTScan predicted protein sequence

MEDSEGSVLNSPVEENLGASDHLSILKGYGAITSX

ESTScan predicted coding region in original sequence      Start : 75 End : 178 Strand : minus

CTCTCTCATCACACACACACACACACAGACGAGCTCAGTTTTTCTGGGACGATCCTAGTTTTGAAGCAACAGTGATGGAGGATTCTGAAG
GGAGCGTCTTGAACTCACCGGTTGAAGAAAACTTGGGTGCTAGTGATCACTTGTCAATTCTGAAAGGCTATGGAGCAATCACAAGTAGX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU35209 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
GO Cellular Component