EST translation and GO annotation for unigene RU35963


ESTScan predicted protein sequence

MVLCRAIDIPSDDCTTAGCNKSFSKASIPDFSTNNRHISX

ESTScan predicted coding region in original sequence      Start : 48 End : 165 Strand : plus

CACGGGCAAGTGCAGCAGAGTGATTTTGGGTGAAATCTTTGAAAACCATGGTGCTATGTAGAGCAATAGACATTCCATCAGATGATTGTA
CAACAGCTGGCTGTAACAAAAGCTTCAGTAAAGCATCAATTCCAGACTTTTCAACAAATAACCGACATATTTCAGXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU35963 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006464-protein modification process
GO Molecular Function
   GO:0005488-binding
  GO:0016881-acid-amino acid ligase activity
GO Cellular Component
   GO:0005622-intracellular