EST translation and GO annotation for unigene RU36176


ESTScan predicted protein sequence

XKAAHSKSLKSNAISIAQGYPPFVGVPHARMPLPLEMAQEPVYVNAKQYQGILRRRQARX

ESTScan predicted coding region in original sequence      Start : 1 End : 178 Strand : plus


XTGAAAGCTGCACATTCTAAATCTCTTAAATCTAATGCTATCTCAATTGCTCAGGGTTATCCTCCTTTTGTTGGAGTGCCACATGCTAGA
ATGCCTTTGCCTCTTGAGATGGCACAGGAGCCTGTATATGTCAATGCAAAACAATACCAAGGGATTCTACGGCGAAGACAGGCACGTGXX



X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF02045    CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B

        GO:0003700     GO:0003700

        GO:0005634     GO:0005634

        GO:0006355     GO:0006355

GO terms for RU36176 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006355-regulation of transcription, DNA-dependent
GO Molecular Function
   GO:0003700-transcription factor activity
GO Cellular Component
   GO:0005634-nucleus