EST translation and GO annotation for unigene RU36717


ESTScan predicted protein sequence

XFKCIKLSYDYLKYDDSKSCFLLCCLFPEDYDIPIDYLFKYGIGKGMFQDY

ESTScan predicted coding region in original sequence      Start : 1 End : 151 Strand : minus


XXTTTCAAATGCATAAAGTTGAGCTATGATTACTTGAAATATGATGATTCCAAATCATGCTTCTTGCTTTGCTGCCTGTTCCCAGAAGAT
TATGATATCCCAATTGACTACTTGTTCAAGTATGGAATCGGGAAAGGAATGTTTCAAGATTAC


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00931    NB-ARC domain

        GO:0005524     GO:0005524

        GO:0006915     GO:0006915

GO terms for RU36717 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006915-apoptosis
  GO:0006952-defense response
GO Molecular Function
   GO:0004721-phosphoprotein phosphatase activity
  GO:0005524-ATP binding
  GO:0016787-hydrolase activity
GO Cellular Component