EST translation and GO annotation for unigene RU37695


ESTScan predicted protein sequence

XKTTLSQLAYNDEKVKANFTKRIWICVSDPFDELNIAKGIIVALDGNVNSLSNDLEAFX

ESTScan predicted coding region in original sequence      Start : 1 End : 173 Strand : plus


XXTAAAACAACCCTTTCCCAACTAGCATATAATGATGAAAAAGTGAAGGCCAATTTCACAAAAAGAATATGGATTTGTGTCTCAGACCCA
TTTGATGAGCTCAACATAGCCAAAGGCATCATAGTTGCCCTTGATGGAAATGTCAATTCCCTTTCAAATGACCTAGAAGCTTTCTXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU37695 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006915-apoptosis
GO Molecular Function
   GO:0005524-ATP binding
GO Cellular Component