EST translation and GO annotation for unigene RU39562


ESTScan predicted protein sequence

XLVQKRHCCEIAGIFXTPEGKGWGVRTLEALPRGAFVREYVGEIVTIDELHERSVLSIGKEHTYPVLLDADWGSQDVLKDEKAL

ESTScan predicted coding region in original sequence      Start : 1 End : 248 Strand : minus


XXGTTAGTACAGAAAAGGCATTGCTGTGAAATTGCAGGTATTTTTGXTACACCCGAAGGGAAAGGGTGGGGTGTAAGAACACTGGAGGCA
TTGCCAAGAGGGGCTTTTGTTCGTGAATATGTTGGAGAGATAGTAACCATCGACGAACTACATGAGCGAAGTGTGCTGAGTATTGGTAAA
GAGCACACCTACCCAGTACTACTAGATGCAGACTGGGGTTCACAGGATGTGTTGAAAGATGAAAAGGCTCTX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00856    SET domain

GO terms for RU39562 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006333-chromatin assembly or disassembly
  GO:0016568-chromatin modification
  GO:0051567-histone H3-K9 methylation
GO Molecular Function
   GO:0003682-chromatin binding
  GO:0005515-protein binding
  GO:0008168-methyltransferase activity
  GO:0008270-zinc ion binding
  GO:0016740-transferase activity
  GO:0018024-histone-lysine N-methyltransferase activity
GO Cellular Component
   GO:0000785-chromatin
  GO:0005634-nucleus
  GO:0005677-chromatin silencing complex