EST translation and GO annotation for unigene RU39702


ESTScan predicted protein sequence

XIEVMKMLGVRSVGLSLSLQKGLPLGSGLGSSAASAAAAAVAVNEIFGGKLGVEA

ESTScan predicted coding region in original sequence      Start : 1 End : 164 Strand : plus


XCCATCGAGGTCATGAAGATGCTCGGCGTCCGCTCCGTCGGCCTCTCCCTCTCTCTCCAGAAAGGCCTGCCTTTGGGAAGCGGGCTCGGA
TCCAGCGCGGCCAGCGCCGCCGCCGCCGCCGTCGCCGTCAACGAGATTTTCGGCGGGAAGTTGGGGGTTGAGGCG


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00288    GHMP kinases N terminal domain

        GO:0005524     GO:0005524

        GO:0016301     GO:0016301

        GO:0016310     GO:0016310

GO terms for RU39702 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
GO Cellular Component