EST translation and GO annotation for unigene RU40000


ESTScan predicted protein sequence

EPLIQRQQEQMVQNEAVDSTFLAAAAAAFGKDER

ESTScan predicted coding region in original sequence      Start : 1 End : 105 Strand : minus


GAACCTTTGATTCAACGGCAGCAAGAACAAATGGTACAAAATGAAGCAGTTGACTCCACTTTCCTTGCTGCTGCTGCTGCTGCGTTCGGC
AAAGATGAAAGATAATTGAGAAATATAAAGGTGCATGTCATGTTATCAACCCCAAAACCCCATAAGAGGAAACTTGTTTACAATCTACAG


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU40000 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
GO Cellular Component