EST translation and GO annotation for unigene RU40327


ESTScan predicted protein sequence

RSRARKQAYTLELEAEVAKLKEMNEELQRKQAEIVEMQKDEILETMQRKWGGKRQCLRRT

ESTScan predicted coding region in original sequence      Start : 1 End : 180 Strand : plus


AGGTCTCGAGCTCGTAAACAGGCCTACACCTTGGAACTAGAGGCAGAAGTTGCAAAACTTAAAGAAATGAATGAAGAATTACAGAGAAAA
CAGGCTGAAATTGTGGAAATGCAGAAAGATGAGATTTTGGAGACAATGCAGCGGAAATGGGGAGGTAAAAGACAATGCTTGAGACGAACA



X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU40327 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006355-regulation of transcription, DNA-dependent
GO Molecular Function
   GO:0003677-DNA binding
  GO:0003700-transcription factor activity
  GO:0043565-sequence-specific DNA binding
  GO:0046983-protein dimerization activity
GO Cellular Component
   GO:0005634-nucleus