Rose Transcriptome Database

EST translation and GO annotation for unigene RU40941

ESTScan predicted protein sequence

LSENPKTPSADRETSVSLKSSKNGEQSDETSCSQDKTLKKPDKILPCPRCNSMDTKFCYYNNYNVNQPAHAX

ESTScan predicted coding region in original sequence Start : 1 End : 215 Strand : minus

TTAAGTGAGAATCCCAAAACTCCCTCAGCTGATAGAGAAACTTCAGTATCTCTGAAATCTTCTAAGAATGGAGAACAGAGTGATGAGACC
AGTTGCTCACAAGACAAGACTCTGAAGAAGCCAGACAAGATACTTCCATGTCCCCGATGTAATAGCATGGACACCAAGTTCTGTTACTAC
AATAACTACAACGTCAATCAGCCCGCCCACGCCATX

X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS

InterProtein domain annotations

Pfam domain annotations

PF02701    Dof domain, zinc finger

        GO:0003677     GO:0003677

        GO:0008270     GO:0008270

        GO:0045449     GO:0045449

GO terms for RU40941 (based on the top Swiss-Prot and TrEMBL hits)

GO Biological Process

GO:0045449-regulation of transcription

GO Molecular Function

GO:0003677-DNA binding
GO:0008270-zinc ion binding