EST translation and GO annotation for unigene RU42981


ESTScan predicted protein sequence

XEREQKIQTEVKEIRKVFYCDLCNKQYKLAVEFEAHLSSX

ESTScan predicted coding region in original sequence      Start : 1 End : 117 Strand : plus


XCAGAACGTGAGCAGAAAATTCAAACTGAGGTGAAAGAAATACGCAAGGTGTTCTACTGTGACCTGTGCAACAAACAATACAAATTGGCT
GTGGAATTTGAAGCTCACTTGAGCTCCTXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU42981 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
  GO:0003676-nucleic acid binding
  GO:0008270-zinc ion binding
GO Cellular Component
  GO:0005622-intracellular