EST translation and GO annotation for unigene RU43444


ESTScan predicted protein sequence

XSVTLNLAADLPVYAIGDEKRLMQTILNVVGNAVKFSKEGSIW

ESTScan predicted coding region in original sequence      Start : 1 End : 127 Strand : plus


XXGTCGGTTACATTAAATTTAGCAGCAGATCTGCCAGTGTATGCGATAGGTGATGAAAAGCGCCTTATGCAAACTATTCTAAATGTTGTT
GGGAATGCTGTGAAGTTTTCAAAAGAAGGGAGCATCTGG
ATTACAGTTTTTGTTGCAAAATCAAATCTTTAAG


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF02518    Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

        GO:0005524     GO:0005524

GO terms for RU43444 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
  GO:0000160-two-component signal transduction system (phosphorelay)
  GO:0006355-regulation of transcription, DNA-dependent
  GO:0007165-signal transduction
  GO:0016310-phosphorylation
  GO:0018106-peptidyl-histidine phosphorylation
GO Molecular Function
  GO:0000155-two-component sensor activity
  GO:0000156-two-component response regulator activity
  GO:0004673-protein histidine kinase activity
  GO:0004871-signal transducer activity
  GO:0004872-receptor activity
  GO:0005524-ATP binding
  GO:0016772-transferase activity, transferring phosphorus-containing groups
GO Cellular Component
  GO:0016020-membrane