EST translation and GO annotation for unigene RU45308


ESTScan predicted protein sequence

XNVGNNFADLRSLPRSIGNLEMLEELDISNNQIRFLPDSFRMLTRLRVLRVEENPLEV

ESTScan predicted coding region in original sequence      Start : 1 End : 172 Strand : plus


XXGAACGTAGGAAACAATTTTGCTGATCTGCGGTCACTACCAAGGTCCATTGGGAACCTTGAGATGCTTGAAGAGTTGGATATCAGCAAT
AACCAGATACGGTTTCTCCCCGACTCTTTCAGGATGCTCACACGACTACGTGTTCTACGTGTAGAAGAAAACCCTCTTGAAGTG


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU45308 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
   GO:0005515-protein binding
GO Cellular Component