EST translation and GO annotation for unigene RU45879


ESTScan predicted protein sequence

XGDSSADQALLSEEENLLIINRLHQVLRPFVLRRLKHKVENELPEKKK

ESTScan predicted coding region in original sequence      Start : 1 End : 142 Strand : plus


XXTGGTGACAGCTCAGCTGATCAAGCCTTATTATCTGAGGAGGAGAATCTATTGATCATAAACCGTCTCCACCAAGTACTTCGACCTTTT
GTCCTTCGGAGGCTGAAGCATAAGGTTGAGAATGAACTACCCGAAAAGAAAAAA


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00176    SNF2 family N-terminal domain

        GO:0003677     GO:0003677

        GO:0005524     GO:0005524

GO terms for RU45879 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0009611-response to wounding
  GO:0009908-flower development
  GO:0010199-organ boundary specification between lateral organs and the meristem
  GO:0040029-regulation of gene expression, epigenetic
  GO:0043044-ATP-dependent chromatin remodeling
GO Molecular Function
   GO:0003676-nucleic acid binding
  GO:0003677-DNA binding
  GO:0003682-chromatin binding
  GO:0004386-helicase activity
  GO:0005524-ATP binding
GO Cellular Component
   GO:0005634-nucleus
  GO:0005829-cytosol