EST translation and GO annotation for unigene RU50705


ESTScan predicted protein sequence

SKMKWYFLRRPRDRKYPNGSPAQSRNRVRLLEGHRHRQGNSQCV

ESTScan predicted coding region in original sequence      Start : 1 End : 135 Strand : plus


AGTAAAATGAAGTGGTACTTCTTACGACGCCCCCGGGACCGGAAGTACCCGAACGGAAGTCCGGCCCAATCGCGCAACCGTGTCAGGTTA
TTGGAAGGCCACCGGCACAGACAAGGCAATTCACAGTGCGTCTAAGTATGTGGGG


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU50705 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0045449-regulation of transcription
GO Molecular Function
   GO:0003677-DNA binding
GO Cellular Component