Rose Transcriptome Database

EST translation and GO annotation for unigene RU51127

ESTScan predicted protein sequence

XEYRTVVKHYKIFYFKHNLLALTFLNNIVLQTDWEGGYFPLTLHFSEDYPSKPPKCKFPANFFHPNVYPSGTVCLSILX

ESTScan predicted coding region in original sequence Start : 1 End : 234 Strand : plus

XCGGAATACAGAACAGTGGTGAAGCACTACAAAATCTTTTATTTTAAACATAATCTTTTGGCTTTGACATTCCTTAATAATATCGTGTTG
CAGACTGACTGGGAGGGTGGGTACTTCCCACTCACACTTCACTTCAGTGAAGACTACCCTAGCAAGCCTCCAAAGTGCAAATTCCCAGCA
AATTTCTTCCACCCGAATGTATATCCATCTGGAACTGTCTGTCTATCAATCCTTAXX

X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS

InterProtein domain annotations

Pfam domain annotations

PF00179    Ubiquitin-conjugating enzyme

        GO:0019787     GO:0019787

        GO:0043687     GO:0043687

        GO:0051246     GO:0051246

GO terms for RU51127 (based on the top Swiss-Prot and TrEMBL hits)

GO Biological Process

  GO:0019941-modification-dependent protein catabolic process
  GO:0043687-post-translational protein modification
  GO:0051246-regulation of protein metabolic process

GO Molecular Function

GO:0016874-ligase activity
GO:0019787-small conjugating protein ligase activity