EST translation and GO annotation for unigene RU51158


ESTScan predicted protein sequence

KYITEGLERARDSLTEAASLRERFVLGTSMSRRVAAAAASAAEAAAAAGEX

ESTScan predicted coding region in original sequence      Start : 1 End : 151 Strand : minus


AAATATATAACAGAAGGTCTTGAACGAGCAAGAGACAGCTTGACTGAAGCTGCATCTTTAAGGGAAAGATTTGTATTGGGTACTAGTATG
AGTAGAAGGGTGGCTGCTGCAGCTGCTTCTGCTGCAGAAGCTGCTGCTGCTGCTGGTGAAAXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU51158 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006887-exocytosis
  GO:0048278-vesicle docking
GO Molecular Function
GO Cellular Component
   GO:0005737-cytoplasm