EST translation and GO annotation for unigene RU51217


ESTScan predicted protein sequence

XTNSQSSQSVRGEEKKKKKKMPSSGFSGTLSGPKVEVAIDMGNPLLNVTVX

ESTScan predicted coding region in original sequence      Start : 1 End : 149 Strand : minus


XXCACAAACTCTCAGTCTTCTCAGAGTGTAAGAGGTGAAGAGAAGAAGAAGAAGAAGAAGATGCCTAGCAGCGGGTTTTCAGGGACACTT
TCCGGGCCGAAGGTTGAGGTGGCCATTGACATGGGTAACCCACTGCTCAATGTCACCGTCGXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU51217 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
GO Cellular Component