Rose Transcriptome Database

EST translation and GO annotation for unigene RU55007

ESTScan predicted protein sequence

LSELVSILVLVASFVYLLGFFGIDFVQTPALKDEEEEEDIIVQEDARVVPCGQALECPVPQIAPKVAQKVVFDERPVTETPPPTX

ESTScan predicted coding region in original sequence Start : 1 End : 253 Strand : minus

CTCTCTGAGCTCGTCTCCATTCTGGTCTTGGTTGCGTCCTTCGTCTACCTCCTCGGCTTCTTCGGCATCGATTTCGTTCAGACCCCAGCT
CTCAAGGACGAAGAAGAAGAAGAAGACATTATTGTCCAGGAGGATGCTCGCGTGGTCCCTTGCGGCCAAGCCCTCGAGTGCCCGGTTCCC
CAGATTGCCCCTAAAGTTGCACAGAAGGTGGTGTTTGATGAAAGGCCGGTGACCGAGACCCCACCACCAACTGXX

X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS

InterProtein domain annotations

Pfam domain annotations

GO terms for RU55007 (based on the top Swiss-Prot and TrEMBL hits)

GO Biological Process

GO:0015936-coenzyme A metabolic process
GO:0055114-oxidation reduction

GO Molecular Function

  GO:0004420-hydroxymethylglutaryl-CoA reductase (NADPH) activity
  GO:0016616-oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
  GO:0050662-coenzyme binding