EST translation and GO annotation for unigene RU56481


ESTScan predicted protein sequence

MDDMNLNAPHSMGTTIIGVTYDGGVVLGADSRASTGVYVANRCSDKITQLTDNSLR

ESTScan predicted coding region in original sequence      Start : 75 End : 242 Strand : plus

AAACCTAAAACCTTTGTATTTCCTTTTCTATTTCCCTTTGTCTCTCTCTCTCTCCAGCTATGTCTCACCCATCAATGGACGATATGAACC
TCAACGCCCCTCACTCCATGGGCACCACCATCATCGGCGTCACCTACGACGGCGGCGTCGTCCTCGGCGCTGACTCCCGCGCCTCCACTG
GTGTCTATGTTGCGAATCGGTGCTCGGATAAAATCACTCAGCTCACGGATAATAGTCTACGT


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00227    Proteasome A-type and B-type

        GO:0004298     GO:0004298

        GO:0005839     GO:0005839

        GO:0006511     GO:0006511

GO terms for RU56481 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0051603-proteolysis involved in cellular protein catabolic process
GO Molecular Function
   GO:0004175-endopeptidase activity
  GO:0004298-threonine-type endopeptidase activity
  GO:0008233-peptidase activity
  GO:0016787-hydrolase activity
GO Cellular Component
   GO:0005737-cytoplasm
  GO:0005829-cytosol
  GO:0005839-proteasome core complex
  GO:0043234-protein complex