EST translation and GO annotation for unigene RU56562


ESTScan predicted protein sequence

MKRERACVEVICDERVGWLVVGGGGGWDGGAASDHGGEIPIVFH

ESTScan predicted coding region in original sequence      Start : 43 End : 175 Strand : plus

AGGTCTGAGTAGTGCTGTCGGAGACAAAACCCTGTTGACCAAATGAAGAGGGAGAGGGCTTGTGTGGAAGTGATCTGTGATGAAAGGGTT
GGTTGGCTTGTTGTTGGTGGTGGTGGTGGTTGGGATGGTGGAGCAGCCTCTGACCACGGCGGTGAGATCCCAATCGTCTTCCAT


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU56562 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
GO Cellular Component