EST translation and GO annotation for unigene RU56643


ESTScan predicted protein sequence

MASANALTSASILCSPRQSLSRRVNQQQINRLNYKQSEGCG

ESTScan predicted coding region in original sequence      Start : 43 End : 165 Strand : minus

CTCTCTCTCTCTCGCTCTCTCTCTCTGCGTGAAGCTTTGAAAATGGCGTCTGCCAACGCTCTCACCTCTGCTTCCATTCTCTGCTCGCCC
AGACAGAGCTTGAGTAGGAGGGTAAATCAGCAGCAAATCAACAGGCTGAATTACAAGCAGTCTGAAGGGTGCGGC


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU56643 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
GO Cellular Component