EST translation and GO annotation for unigene RU57688


ESTScan predicted protein sequence

MGIRFILMVNKQGQTRLAQYYEYLTLEERRALEAEIVRKCLARNEQQCSFVX

ESTScan predicted coding region in original sequence      Start : 87 End : 240 Strand : plus

GTTTTCTGCAGAAACAAAGACAAAAAACAAAAGAGAAGAGAAAGAGCAGAGGAGAGGAGAGAGAGAGAGAGAGAAGAAGAAGAAGAATGG
GGATCAGATTCATATTGATGGTGAACAAACAAGGGCAGACCCGTCTTGCCCAATACTACGAATATCTCACCCTCGAAGAAAGGCGAGCTC
TTGAAGCTGAAATCGTCCGCAAATGCCTCGCCCGCAACGAGCAACAGTGTTCATTTGTCGXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF01217    Clathrin adaptor complex small chain

        GO:0005515     GO:0005515

        GO:0006886     GO:0006886

        GO:0016192     GO:0016192

        GO:0030117     GO:0030117

GO terms for RU57688 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006810-transport
  GO:0006886-intracellular protein transport
  GO:0015031-protein transport
  GO:0016192-vesicle-mediated transport
GO Molecular Function
   GO:0005515-protein binding
  GO:0008565-protein transporter activity
GO Cellular Component
   GO:0030117-membrane coat